PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_9927.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 252aa    MW: 28896.6 Da    PI: 7.2908
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_9927.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll ++v+q G g+W+++a+  g++R++k+c++rw +yl
      MLOC_9927.2 17 KGPWTALEDRLLTEYVQQQGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding52.11.5e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  +++++++lG++ W++Iar+++ gRt++++k++w+++
      MLOC_9927.2  70 RGKITPDEESVILHLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 114
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8371264IPR017930Myb domain
SuperFamilySSF466891.35E-2915111IPR009057Homeodomain-like
SMARTSM007171.8E-131666IPR001005SANT/Myb domain
PfamPF002493.0E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-221871IPR009057Homeodomain-like
CDDcd001674.62E-101964No hitNo description
PROSITE profilePS5129423.12265119IPR017930Myb domain
SMARTSM007172.1E-1569117IPR001005SANT/Myb domain
PfamPF002492.4E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2472117IPR009057Homeodomain-like
CDDcd001672.63E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MAMDAMSSAV LQGGWRKGPW TALEDRLLTE YVQQQGEGSW NSVAKLTGLR RSGKSCRLRW  60
VNYLRPDLKR GKITPDEESV ILHLHAMLGN RWSAIARCLP GRTDNEIKNY WRTHFKKARP  120
SRRARAQLLH QYQLQQQQQH RQYLHALHLL QQQQQQMQMQ MEQESHHHQP QQRQVTMMMP  180
QQSPQDADLQ AVITVGNMNN NMETAECYCP CPAESAVLDL PLPAADEDAL WDSLWRLVDG  240
EDGSSGGDSG EC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26171177106B-MYB
1h8a_C5e-261711727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604501e-173EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562106.11e-100PREDICTED: transcription factor WER-like
TrEMBLM0ZFM00.0M0ZFM0_HORVD; Uncharacterized protein
STRINGMLOC_9927.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-59myb domain protein 305